PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 198aa    MW: 21441.3 Da    PI: 6.9688
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016461genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.18e-40141131100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+rkC +dC++ap+fp e+ ++f  vhk+FGasnv+kll+++ +++reda+s+l+yeA+ar++dPvyG+v+ i+ lq q+e l++el++++
  DCAR_016461  14 PCAACKFLKRKCLPDCIFAPHFPPEELQNFISVHKIFGASNVSKLLNEVLPHQREDAASTLAYEANARLKDPVYGCVRAISILQLQVEGLQKELDEAN 111
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  DCAR_016461 112 AE 113
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99213114IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3914111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MAASFNVVRY NSSPCAACKF LKRKCLPDCI FAPHFPPEEL QNFISVHKIF GASNVSKLLN  60
EVLPHQREDA ASTLAYEANA RLKDPVYGCV RAISILQLQV EGLQKELDEA NAELVNYARG  120
YNHCYHPDIS GTTAAQPAPS AVPVNPMCCY AQIPPQTRPV DLINTGEAGV CNYYRIPSSV  180
TFPRNDTNQG GAAGQGL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1483971e-84FJ148397.1 Daucus carota subsp. sativus clone BAC C055M03 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322187.22e-58hypothetical protein POPTR_0015s09370g
RefseqXP_011046208.12e-58PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046209.12e-58PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML42e-54LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW92e-58B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.17e-58(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-55LBD family protein